- Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0796.1 (MJ0796.1)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1189294
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 15,905 Da
- E Coli or Yeast
- 1-137
- MJ0796.1
- Uncharacterized protein MJ0796.1 (MJ0796.1)
Sequence
MMIDNISNFDKVRAVVVAILLYIFIILVVDGSISSLIGKYITYPSDEYHIIEFYDFIHIIGFLLSLSISTYFSSKDIIKDFAKFFTIFFGITFILGITLFLGLTFFENHIPSMRGYTTLMLFFFLLNLFKKLDKITN